Protein Info for GFF2331 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Quinone oxidoreductase (EC 1.6.5.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 16 to 334 (319 residues), 392.9 bits, see alignment E=4.9e-122 PF08240: ADH_N" amino acids 40 to 97 (58 residues), 28.2 bits, see alignment E=2.1e-10 PF00107: ADH_zinc_N" amino acids 161 to 276 (116 residues), 84.8 bits, see alignment E=7.6e-28 PF13602: ADH_zinc_N_2" amino acids 193 to 333 (141 residues), 88.2 bits, see alignment E=1.5e-28

Best Hits

KEGG orthology group: None (inferred from 52% identity to azl:AZL_017360)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF2331 Quinone oxidoreductase (EC 1.6.5.5) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKTVLAADPQEQQTVMRITAAGGPDVLQPDRAPVPRPRDGEVLIAVKAAGVNRHDCNQRR
RGPTPDHSDVPGLEVAGTVVGVGHGVAAGLMGQPVCALTDGGGYAPFAVAQAAQTLPVPQ
GLSWVEAAALPEAAFTVWHNFFGVARLGAGESVLIHGGTSGVGTLAIQVLNALGHPVYVT
CGSPDKVAAARRLGAREAIDYRREDFVGVLRERTGGRGVDVILDMSGGQYSAANVDVLAR
RGRIVHLSPGAGAVFQAPLRALMAKEAIVTGSLLRPLPDAEKATIAERLRSVVWPLIHSR
RVHPVVHGTLPLAEAAQAHRVMEAGNHIGKIVLVVDPESTPSTGSETP