Protein Info for GFF233 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868
Annotation: Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CYAY_SALTY: Iron-sulfur cluster assembly protein CyaY (cyaY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K06202, CyaY protein (inferred from 94% identity to eco:b3807)MetaCyc: 94% identical to frataxin CyaY (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly" in subsystem Biogenesis of cytochrome c oxidases
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (106 amino acids)
>GFF233 Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868) MNDSEFHRLADALWLTIEERLDSWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV WLATKQGGYHFDLKGDEWVCDRSGETFWDLLEQAATQQAGEKVSFR