Protein Info for GFF2327 in Variovorax sp. SCN45

Annotation: Hydrolase, alpha/beta fold family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12697: Abhydrolase_6
  • amino acids 26 to 245 (220 residues), 52.8 bits, E=3.1e-17
• PF12146: Hydrolase_4
  • amino acids 68 to 238 (171 residues), 49 bits, E=1.8e-16
• PF00975: Thioesterase
  • amino acids 73 to 240 (168 residues), 31.3 bits, E=8.2e-11
• PF00561: Abhydrolase_1
  • amino acids 74 to 239 (166 residues), 52.8 bits, E=1.6e-17
• PF08386: Abhydrolase_4
  • amino acids 192 to 251 (60 residues), 21.6 bits, E=6.8e-08

Best Hits

KEGG orthology group: None (inferred from 85% identity to vpe:Varpa_5016)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (8/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• superpathway of salicylate degradation (6/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (5/6 steps found)
• catechol degradation to β-ketoadipate (3/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (255 amino acids)

>GFF2327 Hydrolase, alpha/beta fold family (Variovorax sp. SCN45)
MAAGHEAYDVTPVAMIAQNPSMPNLVLLPGLACDERIWEAQIPALPQAFNTRVSDAQRHN
GTIEGMAAAVLRDNHGPLVLCGASMGGMVAMEAARQAPERIAGLALLGTSARPETPEMFT
LREGAIEYFERGELRDVIEPNVYFAFHPAQAADPLLVQRYLDIVLGAGAQQLISQNRAVM
RRPDARLHLGSVRAPVLLMCGDDDKLAPPECTNEMAALLPQAEVVWVPACGHMLTMEKPE
LVNAALNDWLAKHFA