Protein Info for PS417_11835 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 11 to 389 (379 residues), 268.2 bits, see alignment E=8e-84 PF07690: MFS_1" amino acids 27 to 357 (331 residues), 184 bits, see alignment E=6e-58 PF06609: TRI12" amino acids 30 to 170 (141 residues), 35 bits, see alignment E=9e-13 PF00083: Sugar_tr" amino acids 42 to 178 (137 residues), 43.8 bits, see alignment E=2.7e-15

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 54% identity to pfl:PFL_2581)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYT5 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PS417_11835 MFS transporter (Pseudomonas simiae WCS417)
MTQRALSTGFWLMLLTALIALPRVTLDMHLPALPAMADYFHTSDSQLQLTLTLYALGSAI
SLLVSGPLTDRFGRRPVLLVGLFLYVLATAACALADNLAVLIIARLFQALGGCCTTVIGR
VMVRDYFDRDEQARLLGLISMAMAISPMAAPVLGSLMLPFINWRGLFVLLGGIGAVLCGV
VYRRLPETRPPEVAAAPPQGLLRLYGQLLRDRYFLRYALAIGCVYSTYFPFISESSALLQ
RGFHLSATAYALVFAATISGYMLGANLFRRLVRRFDPDRLIAVGIGLNLLGSVTLALATT
ALPGEWLAIVLPMVLIMVSVGMTIPACQLSVLQPYGAIAGTASGLFFFTQMLLTAVSSWA
TGLLSDGTSAPLVIMTSVASVLLVTSWLALQQKAAPVTQARLG