Protein Info for PS417_01175 in Pseudomonas simiae WCS417

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details PF00672: HAMP" amino acids 166 to 216 (51 residues), 34.5 bits, see alignment 3.2e-12 PF00512: HisKA" amino acids 222 to 274 (53 residues), 40.6 bits, see alignment 3.2e-14 PF02518: HATPase_c" amino acids 322 to 428 (107 residues), 85.6 bits, see alignment E=5.1e-28

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 97% identity to pfs:PFLU0260)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWX3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>PS417_01175 ATPase (Pseudomonas simiae WCS417)
MKTPLWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVLVDRQYSHGVALTLRAYWAA
DPENREKIAKAATLVRVAGAGVPEGEQHWPYSEIYQRQMQAELGEDTEVRLRMHVSPALW
VRAPSLGEDWLKVPLYPHPLRGQKIWNVLGWFLAIGLLSTASAWIFVRQLNQPLKRLVFA
ARQLGQGRSVRLPVSDTPSEMTEVYGAFNQMAEDVEQAGRERELMLAGVSHDLRTPLTRL
RLSLELMGNHTDLTDDMVRDIEDMDAILDQFLAFIRDGRDEVVEEVDLTDLVREVVAPYN
QNGEQVRMRLEPIQPFALRRVSMKRLLNNLIGNALHHAGSDVEVAAYLSGDSAAPYVVLS
VMDRGAGIDPDELEGIFNPFTRGDRARGGKGTGLGLAIVRRIASMHGGNVELRNREEGGL
EARVRLPLGLMLPRDAV