Protein Info for GFF2319 in Variovorax sp. SCN45

Annotation: Arginine exporter protein ArgO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF01810: LysE" amino acids 19 to 205 (187 residues), 99.8 bits, see alignment E=7.4e-33

Best Hits

Swiss-Prot: 48% identical to Y2008_MYCBO: Putative amino-acid transporter Mb2008 (BQ2027_MB2008) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 85% identity to vpe:Varpa_5023)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>GFF2319 Arginine exporter protein ArgO (Variovorax sp. SCN45)
MQAVQVTPAFVNGLFMSLVLIVAIGAQNAYVLRQGLRREHVGAVVLFCAASDAVLIGAGV
AGMAQALKGRPMLATALAAFGAVFLCTYGLKALWRSRRPAALQATAQGASLSRAAVVAQA
AGFTLLNPHVYLDTVLLVGSAGAQYAGLLKVWFVAGAATASALWFTSLGFGARLLAPVFA
RPRAWQMLDGLIGGTMLLLAAMLAHRAFSGL