Protein Info for GFF2315 in Variovorax sp. SCN45

Annotation: Signal recognition particle receptor FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF02881: SRP54_N" amino acids 139 to 201 (63 residues), 41.7 bits, see alignment E=1.1e-14 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 151 to 420 (270 residues), 325.7 bits, see alignment E=1.2e-101 PF00448: SRP54" amino acids 221 to 421 (201 residues), 238.4 bits, see alignment E=5.5e-75

Best Hits

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 86% identity to vpe:Varpa_5027)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>GFF2315 Signal recognition particle receptor FtsY (Variovorax sp. SCN45)
MFSFFKKKPPADAPVAPAPPPAVAPAPAPEPAPTRSVFSPSSWFGSKPAVEETPVAPAPA
VAPPPAPAPAPTAPAPVVAAPAPAPAPVVAAPPPAPPPVFAPPPAPAPAPVPAPVAAAPV
APERKSWLDKLKTGLRKTGTGIQAVFVNAQIDDALYEELESALLMADTGVKATEYLLEDL
RGRVKRQMATDAGQVKVLLAEAVADLLKPLEKPLVIGQFTPTVIMVAGVNGAGKTTSIGK
LTKHLANEGASVLLAAADTFRAAAREQLLVWADRNTVEIVSQEGGDPSAVSFDAVNAGKA
RGKDVVLVDTAGRLPTQLHLMDELKKIKRIVTKADGTAPHEVLLVIDGNTGQNALAQVKA
FDETLGLTGLIVTKLDGTAKGGVLCAIARERPIPVYFIGVGEKLEDLETFDAREFAQALL
G