Protein Info for GFF2312 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details TIGR00751: 1,4-dihydroxy-2-naphthoate octaprenyltransferase" amino acids 22 to 305 (284 residues), 492.4 bits, see alignment E=2.2e-152 PF01040: UbiA" amino acids 31 to 284 (254 residues), 110.8 bits, see alignment E=3.5e-36

Best Hits

Swiss-Prot: 94% identical to MENA_ECOLI: 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA) from Escherichia coli (strain K12)

KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 99% identity to spq:SPAB_05067)

MetaCyc: 94% identical to 1,4-dihydroxy-2-naphthoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
DMK-RXN [EC: 2.5.1.74]

Predicted SEED Role

"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF2312 1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LALNMTEQQQISRTQAWLESLRPKTLPLAFAAIIVGTALAWWQGYFDPLVALLALITAGL
LQILSNLANDYGDAVKGSDKPDRIGPLRGMQKGVITRQEMKRALIITVVLICISGLALVA
VACHTLTDFVGFLILGGLSIIAAITYTVGNRPYGYIGLGDISVLVFFGWLSVMGSWYLQA
HTLIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGDVNARRYHACLLLG
ALLCLALFNLLSLHSPWGWLFILAAPLLIKQARYVMREREPAAMRPMLERTVKGALLTNL
LFVIGILLSQWAV