Protein Info for GFF2308 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: multi-sensor hybrid histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details PF00512: HisKA" amino acids 324 to 387 (64 residues), 36.4 bits, see alignment E=6.7e-13 PF02518: HATPase_c" amino acids 430 to 551 (122 residues), 83.8 bits, see alignment E=1.8e-27 PF00072: Response_reg" amino acids 574 to 685 (112 residues), 68.5 bits, see alignment E=8.4e-23

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (690 amino acids)

>GFF2308 multi-sensor hybrid histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
LKPLNTDTSPRPPVAWVPWLFALALWLLLVVITSLALWQLHRTALESQGREMKLLSLALT
DELDRGLRGAEEGLQALGLELGQRRLTASDSDTVQALQTRVALMPLVTSLWLLGEDRGPI
AASDTLPPPDLQTFLPRLESLAVGAIALSKPFAQNGDAQPHVALAYRVGAVRGHPGGWII
AAMPANHLLGAFGVALPAADARMAIFRRDGVRLAAVNVGLLGADEAALAAKPRLGMRRFS
DGSDNLVASHRVARYGLEVVLSRELGAVLEGWRGALKLSVVALGFLLVTLVAAVYIVTRS
ERQRLAAQQALQVQLARTSRLEALGALAGGVSHDFNNVLAGIVGYGEMAQDAAVPGSAQA
RHLGKVLQAAERGQSLIERILSFSRGGARASTVFELEPVVEEVLTLMTASLRPGVVLERV
FGAPGARLRGDATQVFEAVMNLCTNAVQAMPEGGMLSVQLERRQVTAPQVLSHSPLPAGR
YLVLSVADQGVGITPEVMEHLFEPFFTARSTQSGTGLGLAVVFGVVAEFGGGIDVDSRPG
QGARFTLYLPECTDELPAAEKAVPTAPGGAGQCVLVVDDEPALLALAQELLTGLGYAPVG
FADAGAALQAVAEAPGRFAAVITDERMPGLSGTELAGALRAQSLDLPVVLVSGYGGAQLA
RRAGDAGVDRVLTKPLRRDELARALAELIP