Protein Info for GFF2305 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cardiolipin synthetase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details PF13396: PLDc_N" amino acids 16 to 59 (44 residues), 26.1 bits, see alignment 1e-09 PF13091: PLDc_2" amino acids 117 to 233 (117 residues), 37.6 bits, see alignment E=2.8e-13 amino acids 313 to 432 (120 residues), 90.6 bits, see alignment E=1.2e-29 PF00614: PLDc" amino acids 381 to 406 (26 residues), 22.2 bits, see alignment (E = 1.6e-08)

Best Hits

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>GFF2305 Cardiolipin synthetase (EC 2.7.8.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLPSQWLTVHGLVVSLAVLVYVFNTHVLRQRRPPISAIAWVLFIVLLPYVALPAFLLFGS
RKHARPSSTAPALPHPPSTADGHWAVDTIVSLRQPPPAAYRDLHLHGDGHQALDALMRTI
DGAQSSLDLCTFILGRHEPGQRVVDRLEAKARQGVRVRLLLDGMGSLMQRPPNLGELTRA
GGELVRFVPPLHSPIRGRTNLRNHRKMLIADAGLPSARLWCGGRNLAPEYFEGSPGQAPW
RDLSFDLGGALVQQARDLFDRDWRFAGGRPAGPRGVSEDTGLAHPVDGAQVVASGPDQAD
DTVLALLLTAAYRARTRIALATPYFVPDTALLTALCLAARRGVAVDLLVPARSNHRLSDL
ARGRALRSLAQAGGRVWLAPGMMHAKLAVFDDTLALNGSVNLDSRSLLLNYELMCAFHRP
TDVRRFTAWFDQERSTAQPYVATAPGLARDIGEGLLLWLGFQL