Protein Info for GFF2302 in Variovorax sp. SCN45

Annotation: Cytochrome c oxidase polypeptide III (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details PF00510: COX3" amino acids 12 to 292 (281 residues), 190.9 bits, see alignment E=1.9e-60

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 95% identity to vpe:Varpa_5049)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF2302 Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Variovorax sp. SCN45)
MSSTTHGATPYYFVPGPSAYPVSAAIGLFFVILGAAQWINGHAWGAWSLLAGMVIWLGTL
FVWFRAAIGESESGQYGHKVDLSFRWSMSWFIFSEVMFFGAFFTALWWARTHALPTLGSL
DNAILWPDFKAVWPSVAAGATGSPAGIVEPFQTVGPFWLPTINTALLLSSGVTLTIAHHA
LRAGHRAQTIRFMWMTVLLGLIFLGVQAYEYHHLYTELNLKLSSGTYGSTFFMLTGFHGL
HVFIGMLMLLFITLRLRKGHFTPERHFGFEGAAWYWHFVDVVWLGLYMLVYWL