Protein Info for PS417_01165 in Pseudomonas simiae WCS417

Annotation: transcription accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 PF09371: Tex_N" amino acids 3 to 76 (74 residues), 107.9 bits, see alignment E=6.1e-35 PF22706: Tex_central_region" amino acids 131 to 307 (177 residues), 253 bits, see alignment E=6.4e-79 PF16921: Tex_YqgF" amino acids 324 to 449 (126 residues), 186.2 bits, see alignment E=1e-58 PF12836: HHH_3" amino acids 489 to 553 (65 residues), 99.3 bits, see alignment E=3.6e-32 PF17674: HHH_9" amino acids 559 to 628 (70 residues), 90 bits, see alignment E=5.2e-29 PF23459: S1_RRP5" amino acids 647 to 716 (70 residues), 27.7 bits, see alignment E=1.1e-09 PF00575: S1" amino acids 647 to 718 (72 residues), 70.3 bits, see alignment E=5.3e-23

Best Hits

Swiss-Prot: 64% identical to YHGF_ECOLI: Protein YhgF (yhgF) from Escherichia coli (strain K12)

KEGG orthology group: K06959, uncharacterized protein (inferred from 99% identity to pfs:PFLU0258)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVC7 at UniProt or InterPro

Protein Sequence (774 amino acids)

>PS417_01165 transcription accessory protein (Pseudomonas simiae WCS417)
MDSINSRIAEELGVRPQQVEAAVALLDEGSTVPFIARYRKEVTGSLDDTQLRHLEERLRY
LRELDERRISILASIEEQGKLTPQLERDIKLADTKTRLEDLYLPYKQKRRTKGQIALEAG
LGDLADGLFNDPSLTPETEAARFIDAEKGVADVKAALEGAKYILMERFAEDASLLEKLRN
YLKQEAILSARVIAGKEEEGAKFRDYFEHDEPLKSMPSHRALAIFRGRNEGILSSALKVG
DELPGTMHPCEGMIGQQFGIQNQNRPADKWLGEVVRWTWKVKLYTHLETDLLGELRDGAE
TEAINVFAHNLHDLLLAAPAGPRATLGLDPGLRTGCKVAVVDSTGKLLDHATVYPHVPHN
KWDQTLAILAALCAKHAVDLIAIGNGTASRETDKLAAELIKKYPAMKMTKVMVSEAGASV
YSASELASKEFPDLDVSIRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSQLKLARG
LDAVVEDCVNAVGVDVNTASVALLARISGLNATLAQNIVNHRDENGAFKTRAALKKVARL
GEKTFEQAAGFLRVMNGDNPLDSSAVHPEAYPLVQRIAAETDRDIRSLIGDAAFLKRLDP
KKYTDETFGVPTITDILQELEKPGRDPRPEFKTAEFQDGVEDLKDLELGMILEGVVTNVT
NFGAFVDIGVHQDGLVHISALSEKFIKDPREAVKAGDVVKVKVMEVDIPRKRVGLSMRMS
DTPGEKIDGARGARPGSAPRQSQNNAPRKETATAAPSNNAMASLFANAKQLKKR