Protein Info for GFF2298 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Autoinducer 2 (AI-2) ABC transport system, periplasmic AI-2 binding protein LsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 37 to 291 (255 residues), 210.9 bits, see alignment E=1.3e-66

Best Hits

Swiss-Prot: 100% identical to LSRB_SALTY: Autoinducer 2-binding protein LsrB (lsrB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10555, AI-2 transport system substrate-binding protein (inferred from 100% identity to sei:SPC_4183)

MetaCyc: 85% identical to Autoinducer-2 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, periplasmic AI-2 binding protein LsrB" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF2298 Autoinducer 2 (AI-2) ABC transport system, periplasmic AI-2 binding protein LsrB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LKFMEKKMARHSIKMIALLTAFGLASAAMTVQAAERIAFIPKLVGVGFFTSGGNGAQEAG
KALGIDVTYDGPTEPSVSGQVQLVNNFVNQGYDAIIVSAVSPDGLCPALKRAMQRGVKIL
TWDSDTKPECRSYYINQGTPKQLGSMLVEMAAHQVDKEKAKVAFFYSSPTVTDQNQWVKE
AKAKISQEHPGWEIVTTQFGYNDATKSLQTAEGIIKAYPDLDAIIAPDANALPAAAQAAE
NLKRNNLAIVGFSTPNVMRPYVQRGTVKEFGLWDVVQQGKISVYVANALLKNMPMNVGDS
LDIPGIGKVTVSPNSEQGYHYEAKGNGIVLLPERVIFNKDNIDKYDF