Protein Info for GFF2297 in Variovorax sp. SCN45

Annotation: Cytochrome c oxidase polypeptide II (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 56 to 78 (23 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details PF02790: COX2_TM" amino acids 37 to 121 (85 residues), 53.2 bits, see alignment E=5.5e-18 TIGR02866: cytochrome c oxidase, subunit II" amino acids 48 to 272 (225 residues), 185.7 bits, see alignment E=3.7e-59 PF00116: COX2" amino acids 134 to 263 (130 residues), 119.2 bits, see alignment E=1.9e-38 PF00034: Cytochrom_C" amino acids 297 to 371 (75 residues), 38.5 bits, see alignment E=4.6e-13 PF13442: Cytochrome_CBB3" amino acids 298 to 368 (71 residues), 46.9 bits, see alignment E=5.8e-16

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 93% identity to vap:Vapar_4392)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF2297 Cytochrome c oxidase polypeptide II (EC 1.9.3.1) (Variovorax sp. SCN45)
MKSIWRNKYRPANLLLAAGAAFSSAAHAVNDLPGGPSVRQLNLPVGVTKIAQEQHLLHTI
MMILCTVIFVAVFAVMFYSIWKHRKSVGHKAANFHESVVVEVIWTIVPFLIVIVMALPAT
KVLVAQKDTTNADLTIKTTGYQWKWGYDYLNGEGEGLAFISTLDSSQRAMSDAGAKGAMP
DDYLLKVDYPLVVPVNKKIRIITTANDVIHAFAVPQLGLKQDAIPGFVRDTWFRAETIGT
YYGQCQELCGKEHAFMPIQVKVVSAADYTAWVADQRKIAAAKLDDPTKVWTLPDMLVRGE
KVYAANCAACHQANGKGAGPIKALDGDPKVLDADHSVQLHVLLNGQNNGAMPSWKQLSDT
DLAAVATYTKNSWSNKTGQLVQPAEVLALRGK