Protein Info for GFF2297 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Autoinducer 2 (AI-2) ABC transport system, membrane channel protein LsrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 38 to 307 (270 residues), 170.4 bits, see alignment E=2.2e-54

Best Hits

Swiss-Prot: 100% identical to LSRD_SALTY: Autoinducer 2 import system permease protein LsrD (lsrD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10557, AI-2 transport system permease protein (inferred from 100% identity to sei:SPC_4182)

MetaCyc: 84% identical to Autoinducer-2 ABC transporter membrane subunit LsrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, membrane channel protein LsrD" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF2297 Autoinducer 2 (AI-2) ABC transport system, membrane channel protein LsrD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNPWRRYSWEIALAALLIFEILAFGLINPRLLDINVLLFSTSDFICIGIVALPLTMVIVS
GGMDISFGSTIGLCAITLGVLFQLGMPLPLAIIITLLLGAICGLINAGLIIYTGVNPLVI
TLGTMYLFGGSALLLSGMAGATGYEGIGGFPTAFTDFANISFLGIPMPLIFFLVCCLFFW
LLMHRTHMGRNVFLIGQSARVAQYSAIPVNRTLYTVYAMTGCASAIAAVLLVSYFGSARS
DLGASFLMPAITAVVLGGANIYGGSGSIMGSALAALLVGFLQQGLQMAGVPNQISSALSG
ALLIVVVVGRSVSLHRHQILEWYSRRRNAHQA