Protein Info for GFF2293 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Autoinducer 2 (AI-2) kinase LsrK (EC 2.7.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00370: FGGY_N" amino acids 2 to 246 (245 residues), 164.5 bits, see alignment E=3.4e-52 PF02782: FGGY_C" amino acids 285 to 452 (168 residues), 67.4 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 100% identical to LSRK_SALTY: Autoinducer-2 kinase (lsrK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11216, autoinducer 2 (AI-2) kinase [EC: 2.7.1.-] (inferred from 99% identity to sek:SSPA3643)

MetaCyc: 83% identical to autoinducer-2 kinase (Escherichia coli K-12 substr. MG1655)
RXN0-5461 [EC: 2.7.1.189]

Predicted SEED Role

"Autoinducer 2 (AI-2) kinase LsrK (EC 2.7.1.-)" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>GFF2293 Autoinducer 2 (AI-2) kinase LsrK (EC 2.7.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MALDAGTGSVRAVIFDLQGKQIAVGQAEWQHLAVPDVPGSMEFDLAKNWQLACQCIRQAL
QKAAIPATAIAAVSACSMREGIVIYDSNGEPIWACANVDARAAHEVSELKELYDNTFEEE
VYRCSGQTLALSAIPRLLWLAHHRPDIYHRASTVTMISDWMAFMLSGELAVDPSNAGTTG
LLDLVTRNWKRSLLQMAGLRSDILSPVKETGTLLGHISQKAAEQCDLQAGTPVIVGGGDV
QLGCLGLGVVRPAQTAVLGGTFWQQVVNLPAPVTDPNMNVRINPHVIPGMVQTESISFFT
GLTMRWFRDAFCAEEKLIAERLGIDAYSLLEDMASRVPPGAYGVMPIFSDVMRFKRWYHA
APSFINLSIDPEKCNKATLFRALEENAAIVSACNLQQIAAFSGVQADSLVFAGGGSKGKL
WSQILADVTGLTVHVPVVKEATALGCAIAAGVGVGVWPSLAETGEKLVRWDREHKPNPEN
FAVYQQAREKWQAVYQDQRALVDGGLTTSLWKAPGL