Protein Info for PS417_11665 in Pseudomonas simiae WCS417

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF07724: AAA_2" amino acids 45 to 222 (178 residues), 134.7 bits, see alignment E=8.3e-43 PF00158: Sigma54_activat" amino acids 47 to 184 (138 residues), 29.4 bits, see alignment E=1.6e-10 PF07728: AAA_5" amino acids 50 to 173 (124 residues), 38.1 bits, see alignment E=3.9e-13 PF00004: AAA" amino acids 50 to 152 (103 residues), 28.2 bits, see alignment E=5.8e-10 PF10431: ClpB_D2-small" amino acids 234 to 301 (68 residues), 37.5 bits, see alignment E=5.1e-13

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2537)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TTM9 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PS417_11665 ATPase AAA (Pseudomonas simiae WCS417)
MRFTFEPAQVMALLRSRIIGQEAALAQVEGLLKVVKADISERDRPLSVNLFMGPTGVGKT
EIVRLLAQALHGRADGFCRIDMHTLAQEHYAAALTGAPPGYVGSKEGISLFNSELIQGTY
SRPGIVLFDELEKASQEVVRSLLGILENGQLTLAGGTRTLDFRNSLIFMTSNIGAQQARR
HRLRFTQGWRRLLRVCARGEAQVLEEALHGHFEPEFLNRIDRILMFEPIDAQWLEALLAV
ELDKLNQRLAVQQRSLVLDAQARAWLCRQHDMRFGARALARRLRVELEPAIAECLLQGNA
LHLSATVRNACLVVEPESTGR