Protein Info for GFF2285 in Xanthobacter sp. DMC5

Annotation: Sensor histidine kinase RegB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 144 (39 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 322 to 428 (107 residues), 51.3 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 87% identity to xau:Xaut_0305)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>GFF2285 Sensor histidine kinase RegB (Xanthobacter sp. DMC5)
MTTAFVTPPHGRSFGLRLDTLIRLRWLAISGQIAALVVVNLGLGFPLPLTSCLAVVGLSA
LVNVLLRVKYPVARRLGDAAAGPLLAYDVLQLTALLYLTGGLKNPFVLLYLAPVMISATA
LAWSTTVMLGILAVACAGAVGLWTRPLPWAGADVPMLPDLYLAGIWVSLSVAVGFIGMHA
WRVAEEARELADALAATELVLAREQHLTAIDGLAAAAAHELGTPLSTIALVVKEMHRSIG
DNSPYSEDVALLRDQVARCRDILQTLTSLRSGDAPFDRMPLALLLEEVVEPHRNFGITIA
VSVKDDPDAPVIARNPGLLYGLGNLVENAVDFAATRVDISAQWTPSGLDIVVADDGPGFS
PEISGRIGQPYVTSRARERQDADLEAESGLGLGFFIAKTLLERTGANLTFENRVPPATGA
VIGIHWPRKALAIEVDGDATKGRALD