Protein Info for GFF2283 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 6-phosphofructokinase (EC 2.7.1.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00365: PFK
  • amino acids 4 to 276 (273 residues), 371.4 bits, E=1.5e-115
• TIGR02482: 6-phosphofructokinase
  • amino acids 4 to 301 (298 residues), 414 bits, E=1.5e-128

Best Hits

Swiss-Prot: 100% identical to PFKA_SALTI: ATP-dependent 6-phosphofructokinase (pfkA) from Salmonella typhi

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 100% identity to seg:SG3359)

MetaCyc: 96% identical to 6-phosphofructokinase subunit (Escherichia coli O157:H7)
Tagatose-6-phosphate kinase. [EC: 2.7.1.144]; 6-phosphofructokinase. [EC: 2.7.1.144, 2.7.1.11]

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (24/26 steps found)
• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (9/9 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• galactitol degradation (5/5 steps found)
• glycolysis IV (8/10 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• 1,3-propanediol biosynthesis (engineered) (7/9 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
• N-acetyl-D-galactosamine degradation (3/5 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.11, 2.7.1.144

Use Curated BLAST to search for 2.7.1.11 or 2.7.1.144

Protein Sequence (320 amino acids)

>GFF2283 6-phosphofructokinase (EC 2.7.1.11) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY