Protein Info for GFF2275 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Predicted rhamnogalacturonide-specific TRAP-type transporter, substrate-binding component RhiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03480: DctP" amino acids 33 to 308 (276 residues), 240.7 bits, see alignment E=1.1e-75 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 33 to 275 (243 residues), 195 bits, see alignment E=7.7e-62

Best Hits

Swiss-Prot: 100% identical to YIIZ_SALTY: Uncharacterized protein YiiZ (yiiZ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to sea:SeAg_B4300)

Predicted SEED Role

"Predicted rhamnogalacturonide-specific TRAP-type transporter, substrate-binding component RhiA" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF2275 Predicted rhamnogalacturonide-specific TRAP-type transporter, substrate-binding component RhiA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKQPGFIRLATLALLSTLSFFSHGETILRLAYAENSQPVKDALHFLGQQVEEKTGGDIKV
QYFPDGQLGGERELVELTQVGVVDITKVSSGLMESFSPEYGVFSLPYLFATVEEYYRVMD
NPQVMEPVYQSTAAQGFIGVGWYDSGARNFYMSKAPIKRIEDLRGKKIRVMQSETAIQTL
KLLGASPIAMSQAEVYTSLQQGILDGAENNEFALTIARHGEVARYYTYDMHTRIPDILLM
STLTLEKLTPEQQRIVEAAIKASIEFEKAAWDKEIEKTRLAAVKDFNVEFYEIDKKPFQE
AVQPIYDGLKNKPRLYGLYQRIQTAKN