Protein Info for PS417_11570 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 63 to 87 (25 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 265 (178 residues), 31 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 33% identical to POTB_SHIFL: Spermidine/putrescine transport system permease protein PotB (potB) from Shigella flexneri

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to pfs:PFLU2527)

MetaCyc: 33% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component I"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGT0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PS417_11570 ABC transporter permease (Pseudomonas simiae WCS417)
MSRGYLLSLPALVLFAGLLILPLGLTLVLSFNVFDYQVGVKADEWTFAHYLSLLSDSYFY
EIFWRTFWISALVTLLCVLIGVPEAYILSRMGTPWRSIFLILILTPLLISVVVRAFGWSL
LLGADGLVNQVIQFLGGRPVKLLYTPFAVIIALVHVMLPFMIIPVWTSLQKLDPSAEQAA
LSLGASQATVMRKIVLPQVMPGVLSGTLIVFGLAASSFAIPGLLGGRRLKMVATVVYDQY
LSELNWPMGATIAVVLLLVNLLIMLSWNRMVEGRYKKSLGV