Protein Info for GFF2269 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 397 to 422 (26 residues), see Phobius details amino acids 442 to 464 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 13 to 423 (411 residues), 248.4 bits, see alignment E=7.1e-78 PF07690: MFS_1" amino acids 17 to 412 (396 residues), 166.2 bits, see alignment E=5.1e-53

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_5074)

Predicted SEED Role

"putative transmembrane efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>GFF2269 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MTDTLDSRKRWLALMVLCLGVLMIVLDTTIVNVALPSIRTDLGFTETSLVWVVNAYMLTF
GGFLLLGGRLGDLYGHRKLFLIGLVLFTLASLACGISNSQVLLVAARAVQGLGGAVVSAV
SLSLIMNLFTEPAERAKAMGVYGFVCAGGGSIGVLLGGLLTSTLSWHWIFLVNLPIGVAV
YALCVALLPSARGHAHGEKLDVAGAVTVTLSLMLAVYGVVNGNEAGWGSTQTVGLLGAAV
VLLAVFIAIEARVQHPLMPLGLFRLRSVSVANVVGVLWAAAMFAWFFISALYMQLVLQYT
PMQIGLAFLPANIIMAVFSLGLSAKIVMRFGIRKPLAAGLWLAAIGLALFARAPVNGSFV
VDVLPGMMLLGLGAGMAFNPMLLAAMSEVSPSDSGLASGVVNTAFMMGGALGLAVLASAA
AARTASMDAAGAQMPLALTGGYNLAFLVGAVFAAAAGLIGVLLLRSAMPGQMQNNNEEEA
APRGTAAS