Protein Info for PS417_11565 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 252 (173 residues), 49.8 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 34% identical to POTC_HAEIN: Spermidine/putrescine transport system permease protein PotC (potC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to pfs:PFLU2526)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2T1 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PS417_11565 ABC transporter permease (Pseudomonas simiae WCS417)
MSRNGPLALGFHGVVVLFMMAPLVVVCLVAFTPENTLSLPTSGFSLRWFRAVFERADFIQ
AFYNSLILAFTAATLATLIAVPAALAISRYTFPGRNFFSALFLSPIIIPHLVLGVAMLRL
FALMGVNGSFTWLMLAHVVIITPYVLRLVLAAAIGIDRSAEQAAESLGASRFTLFRQITL
PMILPGVAGGWLLAFINSFDEVTLSIFVSSPATQTLPVRMYVYATESIDPMMAAVSALVI
ALTAATMILLDRVYGLDRVLVGKH