Protein Info for GFF2267 in Methylophilus sp. DMC18

Annotation: HPr kinase/phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF02603: Hpr_kinase_N" amino acids 4 to 131 (128 residues), 97.3 bits, see alignment E=7.1e-32 TIGR00679: HPr(Ser) kinase/phosphatase" amino acids 5 to 308 (304 residues), 344.7 bits, see alignment E=2.3e-107 PF07475: Hpr_kinase_C" amino acids 136 to 305 (170 residues), 216.7 bits, see alignment E=1.6e-68

Best Hits

Swiss-Prot: 51% identical to HPRK_CHRVO: HPr kinase/phosphorylase (hprK) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K06023, HPr kinase/phosphorylase [EC: 2.7.11.- 2.7.4.-] (inferred from 70% identity to mfa:Mfla_0144)

Predicted SEED Role

"HPr kinase/phosphorylase (EC 2.7.1.-) (EC 2.7.4.-)" in subsystem Mannitol Utilization (EC 2.7.1.-, EC 2.7.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.4.-

Use Curated BLAST to search for 2.7.1.- or 2.7.11.- or 2.7.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF2267 HPr kinase/phosphorylase (Methylophilus sp. DMC18)
MAQISVADLYKQIRSKLKLKWVAGESGGQKILNSGTVTKPSLALVGHLNFVHPNRVQVLG
CAEMDYLGGLSILAMQQAVSNLFSTDLAMVVVANGEKVPSVMLEAAQQSQTPLFTTPMIS
PQLMELLSHYLAVATAETTSLHGVFMEVQGFGVLITGSAAIGKSELALELISRGHRLVAD
DIVDFYRVSPERIEGRCPELLQDFLEVRGLGILNIRALYGDNAVKPTKPLDMMIQLELAD
ELKPQDLDRLSANRQTQQVLDVEISKVIIPIAAGRNIAVLVEAAVRNHMLLLRGVNATKQ
LTQRQKQIMLRESKLR