Protein Info for GFF2263 in Xanthobacter sp. DMC5

Annotation: Efflux pump periplasmic linker BepF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 70 to 405 (336 residues), 281.2 bits, see alignment E=4.5e-88 PF25917: BSH_RND" amino acids 95 to 236 (142 residues), 77.4 bits, see alignment E=2.5e-25 PF25878: HH_AAEA_pHBA" amino acids 131 to 201 (71 residues), 27.6 bits, see alignment E=1.3e-09 PF25881: HH_YBHG" amino acids 133 to 196 (64 residues), 30.8 bits, see alignment E=1.2e-10 PF25876: HH_MFP_RND" amino acids 135 to 204 (70 residues), 42.5 bits, see alignment E=2.6e-14 PF25944: Beta-barrel_RND" amino acids 287 to 328 (42 residues), 46 bits, see alignment 2.3e-15 PF25954: Beta-barrel_RND_2" amino acids 288 to 330 (43 residues), 26.8 bits, see alignment 1.9e-09 PF25967: RND-MFP_C" amino acids 336 to 396 (61 residues), 40.6 bits, see alignment E=8.1e-14

Best Hits

KEGG orthology group: None (inferred from 81% identity to xau:Xaut_0320)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>GFF2263 Efflux pump periplasmic linker BepF (Xanthobacter sp. DMC5)
MTAPNSAQNDTPPTLGTTKPAARKPRLREALLLGTAALLAVFGVLYGLPKEGGAHADKPA
AAAAPPAVPVSVATVEQRDARLFDTFSGRLEAVERVEVRSRVAGAIKAVHFREGALVREG
ELLVSIDPEPYEADVAEAEAQVASVQARLDLARNELERGEKLFTTKTLSQSTLDERLNGQ
RAAEAGLRAAQAKLAAAKLNLSYTKVRAPVSGRVGKSEITVGNLVAAGPGAPVLTTLVSV
DPIYASFSADEATVARALAGLGGGGDVADRLDQIPVLMTLASGVPPVEGVMQLVDNQVDP
RTGTVRVRARFSNPDGRLLPGQFVRLEMGQPKAAPAVLVSERAVGTDQDKKFVFVVDASN
KAVWREVTLGAPVDGLRVVTNGLAAGERVVVNGLHRVRPGAAVTPEPVAMRVSEAAATRT
N