Protein Info for GFF2263 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Rhamnulose-1-phosphate aldolase (EC 4.1.2.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR02624: rhamnulose-1-phosphate aldolase" amino acids 1 to 271 (271 residues), 450.2 bits, see alignment E=1.1e-139 PF00596: Aldolase_II" amino acids 12 to 238 (227 residues), 80 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 100% identical to RHAD_SALNS: Rhamnulose-1-phosphate aldolase (rhaD) from Salmonella newport (strain SL254)

KEGG orthology group: K01629, rhamnulose-1-phosphate aldolase [EC: 4.1.2.19] (inferred from 99% identity to spq:SPAB_05011)

MetaCyc: 92% identical to rhamnulose-1-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Rhamnulose-1-phosphate aldolase. [EC: 4.1.2.19]

Predicted SEED Role

"Rhamnulose-1-phosphate aldolase (EC 4.1.2.19)" in subsystem L-rhamnose utilization (EC 4.1.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF2263 Rhamnulose-1-phosphate aldolase (EC 4.1.2.19) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQNITDSWFVQGMIKATSDAWLKGWDERNGGNLTLRLDEADIAPFAANFHEKPRYIALSQ
PMPLLANTPFIVTGSGKFFRNVQLDPAANLGVVKIDSDGAGYHILWGLTHDAVPTSELPA
HFLSHCERIKATHGKDRVIMHCHATNLIALTYVLENNTALITRKLWEGSTECLVVFPDGV
GILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAEVLVK
IYSMGGMKQTITREELVALGKRFGVTPLASAVALY