Protein Info for GFF2262 in Xanthobacter sp. DMC5

Annotation: Acetyl esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 51 to 69 (19 residues), see Phobius details PF20434: BD-FAE" amino acids 25 to 127 (103 residues), 32.2 bits, see alignment E=8.2e-12 PF07859: Abhydrolase_3" amino acids 34 to 231 (198 residues), 150.2 bits, see alignment E=7.2e-48

Best Hits

KEGG orthology group: None (inferred from 70% identity to xau:Xaut_0321)

Predicted SEED Role

"Acetyl-hydrolase/esterase LipR in mymA operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>GFF2262 Acetyl esterase (Xanthobacter sp. DMC5)
MTPISQTITLETGTGALPARLYGSRPAKGFAPLVFHLHGGAFTSGNLEYGAYISGILAAA
GAVVVSADYPLACEHPFPFALTALFAAVTDVYRRRAALAGRGAPLYLAGEESGGNLAAGL
AMMARDQRSPPIAGQILVSPMLDPSLATASIRRADAGSCGCKWADGWQTYLGSPEKAAHP
YAAPLASARLGALPPALVVSAEDCPMCDESRRYADALASAGVPTCVHILPGPTEWPDSIS
CPAPKPAAWSSAMRDLFRDFFVSTRPASRSGRLKADPAVL