Protein Info for PS417_11535 in Pseudomonas simiae WCS417

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR01514: nicotinate phosphoribosyltransferase" amino acids 11 to 400 (390 residues), 425 bits, see alignment E=1.5e-131 PF17767: NAPRTase_N" amino acids 16 to 136 (121 residues), 90.8 bits, see alignment E=9.2e-30 PF04095: NAPRTase" amino acids 176 to 402 (227 residues), 247.4 bits, see alignment E=1.7e-77

Best Hits

Swiss-Prot: 56% identical to PNCB_PSEPF: Nicotinate phosphoribosyltransferase (pncB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 98% identity to pfs:PFLU2520)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.11

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5L4 at UniProt or InterPro

Protein Sequence (405 amino acids)

>PS417_11535 nicotinate phosphoribosyltransferase (Pseudomonas simiae WCS417)
MESAYDYETPVIQGLLDTDYYTFTMMQAVLHQHPNVDVEYNFIVRSKEKLGHLIPELRAE
LEKMAGLHMREGELRFLFNPRFREYLTPDYERFLGLFRFNLRYIHVSEIDGQLNIRVVGP
MLHCIMFEQPVLALVSELRNRDKYPDVTLEDVTRKLYQKFDWLEKNLSREELADLRVSDF
STRRRLSFKAQREVVDIMRRDFPGQFVGTSNAHLAYEFDLPLIGTMAHQWLMVHQQLGRL
RESQNAALENWVREYRGRLGIALTDCISTDFFLKDFDLYFAKLYDGLRQDSGDPIVWADK
VLARYKQLGIDPMTKDLMFSDGLNFEKCLPILRHVRGKARFGFGMGTSLACDVEGVEPLS
IVMKLVRVHGEPVVKFSDDPVKNVCEDASFLQYAAKVFNVGHVEV