Protein Info for PS417_01145 in Pseudomonas simiae WCS417

Annotation: taurine transporter ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 160 (140 residues), 107 bits, E=6.3e-35

Best Hits

Swiss-Prot: 92% identical to TAUB_PSEF5: Taurine import ATP-binding protein TauB (tauB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 98% identity to pfs:PFLU0254)

MetaCyc: 61% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport ATP-binding protein TauB" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

See A0A1N7U5E8 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PS417_01145 taurine transporter ATP-binding subunit (Pseudomonas simiae WCS417)
MALLQLERISAQYPGATEPVLSDISLDLGPQQLLVALGPSGSGKTSLLNLIAGFVEPSAG
RITLDGVPVKGPSAERGVVFQDDALLPWQDVLANVGFGLELAGVSKAQREVRAREMLALV
DLVGFDSRRIWQLSGGQKQRVGLARALAADPRVLLMDEPFGALDAFTREQMQELLLQVWR
RTAKPVFLITHDIEEAVFLATDLMLLAPNPGQIVERLSLDFGQRYAAGESARAIKSDPRF
IETREHVLGKVFSQRQVSA