Protein Info for GFF226 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) / ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 PF00005: ABC_tran" amino acids 29 to 192 (164 residues), 87.9 bits, see alignment E=1.9e-28 amino acids 314 to 468 (155 residues), 99.5 bits, see alignment E=5e-32 PF08352: oligo_HPY" amino acids 243 to 272 (30 residues), 23.3 bits, see alignment (E = 1.4e-08) amino acids 520 to 542 (23 residues), 17.6 bits, see alignment (E = 8.4e-07) PF13304: AAA_21" amino acids 424 to 503 (80 residues), 29.9 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 90% identity to vpe:Varpa_2845)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>GFF226 ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) / ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MSDNNNKTGQPLIDVKGLRVAFGGKEVVHGIDFQIAAGEKLALVGESGSGKTVTALSLLR
LVQNADVTGEARLYGAERQQAPRDLLSIPERELRGIRGKEIAMIFQEPMTALNALYSVGD
QIAEVLELHEALSARAAQAAAVQLLADTGIPEPARRARAFPHQLSGGQRQRAMIAMALAC
KPRLLLADEPTTALDVTVRAQILDLLADLQHKYGMAVLLITHDLNLVRRFADRVVVMENG
HVVEHGAVAPVFDAPQHPYTRKLIDSHPTRDVAAVQASPAAVPVLEAKALRVIYPVPKPG
IGGWFRKGEFVAVQGADFRIVPGETLGVVGESGSGKSTLALAALGLLKHQGALKIAGKDW
AVDRASDLGLRRVMQVVFQDPFSSLSPRMTVEQIVGEGLRVHAPELGVEARRARSLAALA
DVGLTESQFPSLLDRYPHEFSGGQRQRLAIARALIVDPQLLVLDEPTSALDVTIQKQVLG
LLQRLQRERGLSYLLITHDVEVIRAMAHQVIVMKDGAILETGPVERVLGAPEHPYTKKLV
AAALLE