Protein Info for GFF2258 in Methylophilus sp. DMC18

Annotation: Phosphorylated carbohydrates phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 1 to 169 (169 residues), 81 bits, E=2.3e-26
• PF13419: HAD_2
  • amino acids 1 to 175 (175 residues), 97.5 bits, E=1.6e-31
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 109 to 175 (67 residues), 57.2 bits, E=1.1e-19
• PF13242: Hydrolase_like
  • amino acids 130 to 196 (67 residues), 23.4 bits, E=6.6e-09

Best Hits

KEGG orthology group: None (inferred from 76% identity to rcu:RCOM_1785520)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

• photorespiration I (3/9 steps found)
• photorespiration II (3/10 steps found)
• photorespiration III (2/9 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Protein Sequence (217 amino acids)

>GFF2258 Phosphorylated carbohydrates phosphatase (Methylophilus sp. DMC18)
MDGLLIDSERIIMQGCIEAAASIGITYTEQQYVQLVGRIWSDSSRIMAEQLNGEHHMQQV
IAGLNTYLDARNHVFPLKTGVLELLQFYRDAGITCSVASSSPIPHITHRLSHTGVLDYFD
HVTSGQEVQRGKPNPDIYLLALEKLGLQADECIAFEDSELGAQAAIAAGLRVIVVPDLKQ
PGDLVRAQAFHVVESLLHWHQHHDALMGCVPSADMAE