Protein Info for GFF2257 in Variovorax sp. SCN45

Annotation: RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR03399: RNA 3'-phosphate cyclase" amino acids 2 to 329 (328 residues), 354.7 bits, see alignment E=2.5e-110 PF01137: RTC" amino acids 9 to 331 (323 residues), 260.4 bits, see alignment E=1e-81 PF05189: RTC_insert" amino acids 182 to 272 (91 residues), 35.1 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K01974, RNA 3'-terminal phosphate cyclase [EC: 6.5.1.4] (inferred from 87% identity to vpe:Varpa_5102)

Predicted SEED Role

"RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)" in subsystem RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF2257 RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (Variovorax sp. SCN45)
MIELDGSQGEGGGQILRTSLALSVATGQPLAIEKIRAGRAKPGLMRQHLACVNAAAAISG
AQVEGAELGSQALRFTPGAVRAGEYRFAISGAGSCMLVLQTVLPPLLLAGATSRVQLSGG
THNPMAPPFHFLERAFAPLVRRLGADLQLTLRRCGFYPAGGGEVAAVIVPAGGALQPFDL
TARGAYQESHAECLAPGLPRHVPTRELDTLGVAMGWSGEQLRLGAVRQNEGPGNALMATL
AYEHVTEVFTAFGEKSMSAEQVAHGLAKELRDFQKSEAAVGPHLADQLALLQALAAWQGR
KACVFTCSELTEHTRTNCAVIERFLPVRFTIAEGRQACRVQVAPA