Protein Info for GFF2256 in Xanthobacter sp. DMC5

Annotation: Cell division protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR01174: cell division protein FtsA" amino acids 26 to 405 (380 residues), 311.9 bits, see alignment E=3.1e-97 PF02491: SHS2_FTSA" amino acids 109 to 186 (78 residues), 75.7 bits, see alignment E=5.8e-25 PF06723: MreB_Mbl" amino acids 210 to 379 (170 residues), 27.1 bits, see alignment E=3.9e-10 PF11104: PilM_2" amino acids 214 to 283 (70 residues), 28.6 bits, see alignment E=1.5e-10 PF14450: FtsA" amino acids 232 to 401 (170 residues), 94.3 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 52% identical to FTSA_RHIME: Cell division protein FtsA (ftsA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03590, cell division protein FtsA (inferred from 96% identity to xau:Xaut_0327)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>GFF2256 Cell division protein FtsA (Xanthobacter sp. DMC5)
MRGRLAQGFAPKMRPLPPKKGGIVGVLDIGTSKVVCAIARLKPRGASDVLTRRTHAIDVL
GIGHTRAHGIKGGAVVDMAKAELAIRQAVDMAERASGVQIASVVVGVSGGRLASQHYEAA
VRLSAPAVEEFDIRRVLEAASTYAVGDGRAVMHALPVGYSLDGRRGIGEPCGMLGRELGA
DMHVITADLTALKNLVLCVERCHLSIEAMVAAPYAAALSSLTDDEMELGVTLIDMGAGTT
TFSIVAGGHCVYVDGVALGGQHITNDVARGMPARLADAERLKALHGAVVAVSSDDHDMLT
VPPLSGDSRDQPHMVPKSRLVTIVKPRAEEIVELLRDRLRASGHAGDAGRRIVLTGGAAQ
LQGLADLVARVIGPQVRIGRPLGVSRLPEAARGAAFAVTAGLLVYPQVAGLEHFEPRRRQ
AAVGEGPGYFGRVGRWLKDSF