Protein Info for GFF2255 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 69 to 95 (27 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 184 to 210 (27 residues), see Phobius details amino acids 230 to 255 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 255 (169 residues), 103.7 bits, see alignment E=5.3e-34

Best Hits

Swiss-Prot: 36% identical to RIBX_CHLAA: Riboflavin transport system permease protein RibX (ribX) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 43% identity to bja:bll4208)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF2255 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Hydrogenophaga sp. GW460-11-11-14-LB1)
VNESPMTMTQNKLARWTAHYLPAIGLFVGFIALWQLAVSVFGIREYLLPSPYSVWQAMLS
DEIPWLSHAWITGVEILGAFVLAGVAGVVLGMAIAWSPGISRALTPFLVFVNTLPKVAIA
PLFLMWLGYGILPNMLIGALIGFFPVVINTAVGLTQIDQDMVDLGRVFSAPKWKVFMKIR
IPNAYPYILSALKVTATSAVVGAVVGEFVASQKGLGYVIITTQSSMNTPAAFAALVXISV
LGLLLYGLVALLSRLLAPWAEEAPR