Protein Info for GFF2250 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: formate dehydrogenase formation protein FdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01562: formate dehydrogenase accessory protein FdhE
  • amino acids 2 to 305 (304 residues), 506.1 bits, E=2.1e-156
• PF04216: FdhE
  • amino acids 22 to 304 (283 residues), 392.6 bits, E=8.6e-122

Best Hits

Swiss-Prot: 100% identical to FDHE_SALNS: Protein FdhE (fdhE) from Salmonella newport (strain SL254)

KEGG orthology group: K02380, FdhE protein (inferred from 99% identity to spt:SPA3876)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Protein Sequence (309 amino acids)

>GFF2250 formate dehydrogenase formation protein FdhE (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSIRIIPQDELGSSEKRTADMIPPLLFPRLKNVYNRRAERLRELAENNPLGDYLRFAALI
AHAQEVVLYDHPLEMDLTARIKEANDQGKPPLDIHVLPRDKHWQKLLHSLIAELKPEMSG
PALAVIENLEKASEQELEQMASALFASDFASVSSDKAPFIWAALSLYWAQMASLIPGKAR
AEYGEARQYCPVCGSMPVSSMVQIGTTQGLRYLHCNLCETEWHVVRVKCSNCEQSRDLHY
WSLENEQAAVKAESCGDCGTYLKILYQEKDPKVEAVADDLASLVLDARMEQEGFARSSIN
PFLFPGEGE