Protein Info for PS417_01140 in Pseudomonas simiae WCS417

Annotation: taurine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 270 (170 residues), 90.5 bits, see alignment E=5.7e-30

Best Hits

Swiss-Prot: 64% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 95% identity to pfs:PFLU0253)

MetaCyc: 64% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TU77 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PS417_01140 taurine ABC transporter permease (Pseudomonas simiae WCS417)
MSSYELPVMTAKPAAHAPIPVRRSLSTRWISLLTLVALLIIWWAVTATGVIEPLFLPPPS
AVLQKGWLLATTGYMDSTLWQHLSASLSRIGLGLGFAVLTAVPVGIAIGSNRIARGILDP
LIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAIATATGVRTVDPAKLRAAQ
SLGATRAQLIRHVILPSALPDILTGVRIGLGVGWSTLVAAELIAATSGLGFMVQSAAQFL
VTDVVVLGILVIALIAFAMEMGLRALQRKLVPWHGQAH