Protein Info for GFF2248 in Xanthobacter sp. DMC5

Annotation: Competence protein ComM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 TIGR00368: Mg chelatase-like protein" amino acids 9 to 500 (492 residues), 533.1 bits, see alignment E=3.2e-164 PF13541: ChlI" amino acids 20 to 138 (119 residues), 136.6 bits, see alignment E=1.2e-43 PF01078: Mg_chelatase" amino acids 189 to 394 (206 residues), 320 bits, see alignment E=1.7e-99 PF00158: Sigma54_activat" amino acids 199 to 345 (147 residues), 25 bits, see alignment E=4e-09 PF07728: AAA_5" amino acids 212 to 348 (137 residues), 38.9 bits, see alignment E=2.6e-13 PF00493: MCM" amino acids 285 to 347 (63 residues), 23.8 bits, see alignment E=6.5e-09 PF13335: Mg_chelatase_C" amino acids 402 to 500 (99 residues), 98.4 bits, see alignment E=8.6e-32

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 94% identity to xau:Xaut_0335)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>GFF2248 Competence protein ComM (Xanthobacter sp. DMC5)
VIQRVATVAFEGVEARPVDVQVHVAAGLPAFTIVGLPDKAVTEAKERVRAALIASGLALP
ARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPGDALTGFTVVGELALDGAIAAVAG
VLPAAIGANARGHGLICPAPCGAEAAWASPDMDILAPQSLIQLANHMTGRQVMGRPEPRM
KPPGDTMLDLRDVKGQETAKRALEVAAAGGHNLLFVGPPGAGKSMLAQRLPSILPPLAPA
EMLDVSMIASVAGTIEDGALMDRRPFRAPHHSASMAAMVGGGAKAKPGEVSLAHNGVLFL
DELPEFAPQVLDSLRQPLETGEVLIARANHRVTYPARFQLIAAMNPCRCGRAGEPGFTCK
RGPRCADEYQARLSGPFLDRIDIHLEVPSVSASDLVLPAPTEGSREVAARVAMAREIQLE
RYAALGRPDVRTNAEASGPLLETVATPDSAGAVLLRDAADAMRLSARGYHRVLKVARTLA
DLEGAEGVGRRHLAEALAYRAAAERPRAAA