Protein Info for GFF2247 in Xanthobacter sp. DMC5

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF13489: Methyltransf_23" amino acids 42 to 198 (157 residues), 66 bits, see alignment E=1.5e-21 PF01209: Ubie_methyltran" amino acids 43 to 162 (120 residues), 67.6 bits, see alignment E=5e-22 PF03848: TehB" amino acids 44 to 159 (116 residues), 22.1 bits, see alignment E=4.2e-08 PF03141: Methyltransf_29" amino acids 48 to 150 (103 residues), 26.4 bits, see alignment E=1.2e-09 PF00891: Methyltransf_2" amino acids 51 to 195 (145 residues), 25.6 bits, see alignment E=3.2e-09 PF13847: Methyltransf_31" amino acids 52 to 154 (103 residues), 74.3 bits, see alignment E=4.2e-24 PF13649: Methyltransf_25" amino acids 54 to 146 (93 residues), 77.3 bits, see alignment E=5.7e-25 PF08241: Methyltransf_11" amino acids 54 to 150 (97 residues), 87.1 bits, see alignment E=4.5e-28 PF08242: Methyltransf_12" amino acids 54 to 148 (95 residues), 56.3 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: None (inferred from 77% identity to xau:Xaut_0336)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF2247 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (Xanthobacter sp. DMC5)
MAAEGAGVRSHEAHVVEMFGPQAAVYVASAVHARGADLDALKALVEETRPARLLDLGCGG
GHVSFTAAPFAGEVVAYDLSEDMLGAVAAEARARGLANIATRQGVAERLPFADGSFDMVA
SRYSAHHWRDVPQALAEVRRVVKSGGQFVMMDVIAPEWPVADTFLQTVELLRDPSHGRDY
SASEWTRLAEEAGFRVVRTAHRRLRLEFASWVARIRTPELHVAAIRSLMAGASADVAAHF
EFEADGSFSIDTLTLELETA