Protein Info for GFF2239 in Xanthobacter sp. DMC5

Annotation: Signal transduction histidine-protein kinase AtoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF00989: PAS" amino acids 79 to 184 (106 residues), 39.3 bits, see alignment E=1.5e-13 TIGR00229: PAS domain S-box protein" amino acids 81 to 188 (108 residues), 30.1 bits, see alignment E=2.3e-11 PF08448: PAS_4" amino acids 82 to 188 (107 residues), 46.6 bits, see alignment E=9.4e-16 PF13426: PAS_9" amino acids 87 to 180 (94 residues), 29.4 bits, see alignment E=2e-10 PF02518: HATPase_c" amino acids 353 to 464 (112 residues), 85.2 bits, see alignment E=1.1e-27

Best Hits

KEGG orthology group: None (inferred from 83% identity to xau:Xaut_0344)

Predicted SEED Role

"Signal transduction histidine kinase HoxJ (hydrogenase regulation)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>GFF2239 Signal transduction histidine-protein kinase AtoS (Xanthobacter sp. DMC5)
MPMSGRKDTPREQLPDSPLAGALSLPRAGSDFGAIDADEAWIAVIRKMDETYAELVRQQV
ELEAKNTALEEAQGFIAGLLGSMTDVLVACDLSGRVEQVNLAAERAFGLRADALLGRPLS
DLLDPSSETTAADVLATVARRQRIADREFTLATPDGPLAIAVNGALRFDPRGRAVGIVLV
GRPIGELRAAYGALAKAHEHLKRTQQQLVHAEKMASLGRLVAGVAHELNNPISFVYGNAH
AMKRYAERLIAYLDQVHAGADATALAKARGELRIDRALSDIPATLSGMLEGAERVRDIVA
DLRRFSSDRREAREVFDLAGVVRSAVDWVAKSQMPDLPITVAVPEGLEAVGHPGHIHQVM
MNLVQNAVDAMEGRADRRLEITGARFETPDGLQVAVRVRDTGPGIPDALMDRIFDPFFTT
KPVGKGTGLGLSICYRIAEEHEGRLEAANHPEGGAILSLVLPAAP