Protein Info for GFF2239 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DeoR-type transcriptional regulator YihW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF25212: HVO_A0114" amino acids 10 to 60 (51 residues), 28.2 bits, see alignment 3.7e-10 PF08220: HTH_DeoR" amino acids 11 to 66 (56 residues), 74.7 bits, see alignment E=1.1e-24 PF12802: MarR_2" amino acids 14 to 64 (51 residues), 29.2 bits, see alignment 2.6e-10 PF01047: MarR" amino acids 14 to 57 (44 residues), 31.5 bits, see alignment 4e-11 PF08279: HTH_11" amino acids 15 to 53 (39 residues), 37 bits, see alignment 7.4e-13 PF00455: DeoRC" amino acids 80 to 237 (158 residues), 163.2 bits, see alignment E=1.5e-51

Best Hits

Swiss-Prot: 89% identical to CSQR_ECOLI: HTH-type transcriptional repressor CsqR (csqR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ses:SARI_03641)

Predicted SEED Role

"DeoR-type transcriptional regulator YihW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF2239 DeoR-type transcriptional regulator YihW (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSLTELTGNPRHDRLLMLIDERGYMNIDELASLLEVSTQTVRRDIRKLSEQGLITRHHGG
AGRASSVVNTAFEQREVSWTQEKKAIAEAVADYIPDGSTIFITIGTTVEQVARALLNHNH
LRIITNSLRVAHILYNNPRFEVMVPGGTLRPHNSGIIGPSAAAFVAGFRADYLVTSVGAI
ESDGALLEFDVNEASVVKTMMAHSRHILLAADHTKYHASAAVEIGNVSQITALFTDEYPG
PALQNLLQSQQIEVVQVSPSLDDAVSA