Protein Info for GFF2238 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sugar kinase YihV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 85% identical to SQUV_ECOLI: Sulfofructose kinase (yihV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sed:SeD_A4413)

MetaCyc: 85% identical to 6-deoxy-6-sulfofructose kinase (Escherichia coli K-12 substr. MG1655)
RXN-15297 [EC: 2.7.1.184]

Predicted SEED Role

"Sugar kinase YihV"

MetaCyc Pathways

sulfoquinovose degradation I (4/5 steps found)
sulfoquinovose degradation VI (3/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.184

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF2238 Sugar kinase YihV (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVRIACVGITVMDRIYYVEGLPTEGGKYVAKRYTEVGGGPAATAAVAAAKLGAQVDFIGR
VGDDDTGNSLLAELESLGVNTRYTRRYTQAMSSQSAIMVDAKGERIIVNYPSPDLLPDAD
WLNDIDFSQWDVVLADVRWHDGAKQAFTLARQAGVMTVLDGDITPQDISELVALSDHAAF
SEPGLARLTGMSEAIDALKKAQMLTNGHVYVTRGSEGCNWLEKAAVRHQPGFTVEVVDTT
GAGDVFHGALAFGLASGYAIEEAVRFASGVAALKCTRPGGRAGIPDCEQTRSFLSLFV