Protein Info for GFF2237 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 4 to 161 (158 residues), 164.3 bits, E=3.6e-52
• PF03807: F420_oxidored
  • amino acids 4 to 93 (90 residues), 29.2 bits, E=1.8e-10
• PF14833: NAD_binding_11
  • amino acids 165 to 284 (120 residues), 90.9 bits, E=1.1e-29

Best Hits

Swiss-Prot: 100% identical to SQUU_SALTY: 3-sulfolactaldehyde reductase (yihU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08318, putative dehydrogenase [EC: 1.1.-.-] (inferred from 98% identity to spq:SPAB_04982)

MetaCyc: 87% identical to 3-sulfolactaldehyde reductase (Escherichia coli K-12 substr. MG1655)
4-hydroxybutyrate dehydrogenase. [EC: 1.1.1.61]; RXN-15299 [EC: 1.1.1.61, 1.1.1.373]

Predicted SEED Role

No annotation

MetaCyc Pathways

• sulfoquinovose degradation I (4/5 steps found)
• 4-aminobutanoate degradation V (3/7 steps found)
• succinate fermentation to butanoate (1/7 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Bisphenol A degradation
• Butanoate metabolism
• Ethylbenzene degradation
• Limonene and pinene degradation
• Naphthalene and anthracene degradation
• Retinol metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.-.-

Use Curated BLAST to search for 1.1.-.- or 1.1.1.373 or 1.1.1.61

Protein Sequence (298 amino acids)

>GFF2237 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAVIAFIGLGQMGSPMASNLLKQGHQLSVFDVNPDAVQRLVDKGAQPASSPAQATIGAEF
VITMLPNGDLVRSVLFGEQGVCETLSREALVIDMSTIHPLQTDNLIADMQSKGFSMMDVP
IGRTSDNAITGTLLLLAGGTAEQVERATPVLMAMGNELVNTGGPGMGIRVKLINNYMSIA
LNALSAEAAVLCEALGLSFDVALKVMSGTAAGKGHFTTTWPNKVMKGDLSPAFMIDLAHK
DLGIALDVANQLHVPMPLGAASREVYNLARAAGRGREDWSAILEQVRISAGLTANVKK