Protein Info for GFF2232 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glucuronide transport protein YihP, homologous to YihO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 308 to 326 (19 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details amino acids 419 to 441 (23 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 18 to 456 (439 residues), 522.3 bits, see alignment E=4.3e-161 PF13347: MFS_2" amino acids 20 to 443 (424 residues), 271.4 bits, see alignment E=1.1e-84

Best Hits

Swiss-Prot: 100% identical to YIHP_SALTY: Putative 2,3-dihydroxypropane-1-sulfonate exporter (yihP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03292, glycoside/pentoside/hexuronide:cation symporter, GPH family (inferred from 99% identity to seg:SG3407)

MetaCyc: 66% identical to putative sulfoquinovose transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-580

Predicted SEED Role

"Glucuronide transport protein YihP, homologous to YihO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>GFF2232 Glucuronide transport protein YihP, homologous to YihO (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSQTSSNPATLRLPFKEKLAYGLGDLGSNILLDIGTLYLLKFYTDVLGLPGTYGGIIFLI
AKFFTAFTDMGTGIMLDSRRKIGPKGKFRPFVLYAAFPVTLLAIANFVGTPFEVTGKTVV
ATMLFMLYGLVFSMMNCSYGAMVPAITKNPDERASLAAWRQGGATLGLLLCTVGFVPVMN
LIEGNAQLSYIFAATLFSLFGLLFMWLCYAGVKERYVEVKPVDSAQKPGLLQSFRAIAGN
RPLFILCIANLCTLGAFNVKLAIQVYYTQYVLNDPILLSWMGFFSMGCIFIGVFLMPGAV
RRFGKKKVYIGGLLIWVAGDLLNYFFGGGSVSFVAFSCLAFFGSAFVNSLNWALVSDTVE
YGEWRTGVRSEGTVYTGFTFFRKVSQALAGFFPGWMLTQIGYIPNVVQSAGTVEGLRQLI
FIYPCVLAVITIIAMGCFYNLNEKMYVRIVEEIEARKHTV