Protein Info for GFF2231 in Xanthobacter sp. DMC5

Annotation: Chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 89.8 bits, see alignment E=1.9e-29 TIGR02349: chaperone protein DnaJ" amino acids 5 to 352 (348 residues), 432 bits, see alignment E=1e-133 PF01556: DnaJ_C" amino acids 121 to 335 (215 residues), 176.7 bits, see alignment E=6.9e-56 PF00684: DnaJ_CXXCXGXG" amino acids 148 to 208 (61 residues), 55 bits, see alignment E=1.6e-18 PF27439: DnaJ_C_2" amino acids 341 to 374 (34 residues), 46 bits, see alignment 8.6e-16

Best Hits

Swiss-Prot: 91% identical to DNAJ_XANP2: Chaperone protein DnaJ (dnaJ) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 91% identity to xau:Xaut_0352)

MetaCyc: 56% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF2231 Chaperone protein DnaJ (Xanthobacter sp. DMC5)
MAKRDYYETLGCDRGADETVLKASYRKLAMKWHPDRNQGDAEAEVMFKEVNEAYEVLKDP
QKRAAYDRFGHAAFENGGGGPGFGNDFASSFADIFDDLFGGAMGRGRGGGGGQQRGRGSD
LRYNMEITLEEAFVGKTAQIKIPTSVACEACNGTGAKPGTQPKACRTCGGAGKIRHAQGF
FTLERTCPTCQGRGSVIEDPCGACAGAGRVTRERTLSVQIPPGVEDGTRIRLGGEGEAGV
RGGPAGDLYIFLSIEQHAFFQREGADLYCRVPISMVTAALGGAVEVPTIDGDKTKVKIPE
GTQSQKRFRLSGKGMPILRSRSAGDMYVQVVVETPQKLTKRQRELLAEFDKESSGETHPE
SAGFFAKVKEFFQGAAGEGA