Protein Info for GFF2231 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glucuronide transport protein YihO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 16 to 452 (437 residues), 517.5 bits, see alignment E=1.2e-159 PF13347: MFS_2" amino acids 18 to 439 (422 residues), 285.3 bits, see alignment E=6.6e-89

Best Hits

Swiss-Prot: 100% identical to YIHO_SALTY: Putative sulfoquinovose importer (yihO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03292, glycoside/pentoside/hexuronide:cation symporter, GPH family (inferred from 99% identity to sed:SeD_A4405)

MetaCyc: 80% identical to putative sulfoquinovose transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-580

Predicted SEED Role

"Glucuronide transport protein YihO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF2231 Glucuronide transport protein YihO (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSNHDPLTLKLSLREKCAYGVGDFGSNLMLCIGTLYLLKFYTDELGMPAYYGGIIFLVAK
FFTAFTDMLTGVLLDSRRNIGAKGKFRPFILYASFPVALVATAQFFATHFTLPVKTAFAT
VLFMLFGLFYSLMNCSYGAMVPAITKNPHERAQLAAWRQGGATIGLLLCTVGFMPIQALF
TRSPSLGYLIAAVIFSVCGLFSMWWCFSGVKERYIETVPDTHKPSILKSFCAIFRNPPLL
VLCVANLCTLAAFNIKLAIQVYYTQYVLNDIHLLSWMGFFSMGCILIGVLLVPAAVKRFG
KKQVYLGGLILWAVGDILNFIWGGTSFLFVIFSCIAFFGTAFVNSLNWALVPDTVDYGEW
KTGIRAEGSVYTGYTFSRKISAALAGFLPGIMLTQIGYIPNIAQSDTTLLGLRQLIFLWP
CGLAIIAALTMGFFYKLNEQRFAFIIEEIAQRKKTGNQIVATNNKQSISTVNN