Protein Info for GFF223 in Variovorax sp. SCN45

Annotation: Transcription termination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF08529: NusA_N" amino acids 4 to 127 (124 residues), 120.9 bits, see alignment E=1.2e-38 TIGR01953: transcription termination factor NusA" amino acids 5 to 343 (339 residues), 394.2 bits, see alignment E=4.6e-122 PF00575: S1" amino acids 138 to 194 (57 residues), 25.4 bits, see alignment 4.4e-09 PF13184: KH_NusA_1st" amino acids 201 to 278 (78 residues), 106.2 bits, see alignment E=2.5e-34 PF26594: KH_NusA_2nd" amino acids 282 to 346 (65 residues), 79.7 bits, see alignment E=3.5e-26 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 367 to 416 (50 residues), 65.5 bits, see alignment 3.4e-22 amino acids 444 to 492 (49 residues), 52.9 bits, see alignment 3.1e-18 PF14520: HHH_5" amino acids 435 to 490 (56 residues), 36.2 bits, see alignment 2.1e-12

Best Hits

Swiss-Prot: 52% identical to NUSA_COXBU: Transcription termination/antitermination protein NusA (nusA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 98% identity to vpe:Varpa_2848)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>GFF223 Transcription termination protein NusA (Variovorax sp. SCN45)
MNREMLMLVDAISREKNVERDVVFGAVESALAQATKKLHQGDVDIRVSVDRDSGDYETFR
RWHVVPDEAGLQLPDQEILLFEAKEEMSDIEVGEYIEEAVESVPIGRIGAMAAKQVILQK
IRDAEREMLLNDFMSRGDKIFVGTVKRLDKGDIIVEAGRVEGRLRRSEMIAKENLRNGDR
VRAMIMEVDLTLRGAPIILSRSAPEFMIELFRQEVPEIEQGLLEIKSCARDPGSRAKIAV
LSHDKRVDPIGTCVGVRGTRVNAVTNELAGERVDIVLWSEDPAQFVIGALAPANVSSIVV
DEEKHAMDVVVDEENLAIAIGRGGQNVRLASDLTGWKINIMDANESAQKQATETDASRKL
FMEKLDVDEEIADILISEGFNSLEEVAYVPISEMLEIEAFDEDTINELRSRAKDALLTME
IAKEEGVEGAPQVSQDLHDLEGLDPELIPKLVEAGVNTRDDLADLAVDELTEITGHSADD
AKALILKAREHWFAGQE