Protein Info for GFF223 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Na(+)Citrate OH(-) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 361 to 386 (26 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details TIGR00783: citrate carrier protein, CCS family" amino acids 18 to 441 (424 residues), 592.8 bits, see alignment E=1.9e-182 PF03390: 2HCT" amino acids 23 to 440 (418 residues), 521.5 bits, see alignment E=6.4e-161

Best Hits

Swiss-Prot: 100% identical to CITN_SALPU: Citrate-sodium symporter (citP) from Salmonella pullorum

KEGG orthology group: None (inferred from 100% identity to spt:SPA0058)

MetaCyc: 68% identical to citrate:Na+ symporter (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-501

Predicted SEED Role

"Na(+)Citrate OH(-) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>GFF223 Na(+)Citrate OH(-) antiporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFYNAIPTDLVGGFALMFV
MGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQKEIDAISNVMDKSNFLNLF
IAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGIVIGLCFGIPVDRIMMLYVLP
IMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIANIFAIIFAALLDMIGKKYTWL
SGEGELVRKASFKTEDDEKAGQITHRETAVGMVLSTTCFLLAYVVAKKILPSIGGVSIHY
FAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSKQLLWVLMVGVGVCYTDLQEIIDALTF
ANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCMANRGGSGDLEVLSACNRMNLI
SYAQISSRLGGGIVLVIASIVFSMMV