Protein Info for GFF2227 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ni,Fe-hydrogenase I cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 115 to 131 (17 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details TIGR02125: Ni/Fe-hydrogenase, b-type cytochrome subunit" amino acids 27 to 240 (214 residues), 252.4 bits, see alignment E=1.5e-79 PF01292: Ni_hydr_CYTB" amino acids 28 to 234 (207 residues), 108.9 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 70% identical to CYBH_CUPNH: Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hoxZ) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03620, Ni/Fe-hydrogenase 1 B-type cytochrome subunit (inferred from 89% identity to rme:Rmet_1295)

MetaCyc: 70% identical to hydrogenase b-type cytochrome subunit (Cupriavidus necator)
Hydrogenase (acceptor). [EC: 1.12.99.6]

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>GFF2227 Ni,Fe-hydrogenase I cytochrome b subunit (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTPSSTAHANADALELQQGQTIRSVYVYEVPVRLWHWINALSITVLCVTGYFIGQPLPT
MPGEASANYLMGYIRFAHFAAGYIMAVGLVARAYWALVGNHHAKELFWVPLFQKAYWREV
FNMLRWYLFLIPKPNQYVGHNPLARFAMFAFYLMLSIFMIVTGFALYSEGSQAGSWQDHL
FGWVIPLMGQSQDVHTWHRLGMWGIVTFVLLHIYAAIREDIMGRQSIVSTMISGHRTFKE