Protein Info for PS417_11350 in Pseudomonas simiae WCS417

Annotation: biopolymer transporter ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 370 to 389 (20 residues), see Phobius details amino acids 494 to 517 (24 residues), see Phobius details amino acids 525 to 549 (25 residues), see Phobius details PF10102: DUF2341" amino acids 71 to 155 (85 residues), 73.4 bits, see alignment E=3.3e-24 PF13385: Laminin_G_3" amino acids 197 to 326 (130 residues), 80.1 bits, see alignment E=4e-26 PF02210: Laminin_G_2" amino acids 226 to 320 (95 residues), 25.7 bits, see alignment E=2.8e-09 PF01618: MotA_ExbB" amino acids 457 to 564 (108 residues), 89.2 bits, see alignment E=3.7e-29

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 96% identity to pfs:PFLU2434)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWW8 at UniProt or InterPro

Protein Sequence (599 amino acids)

>PS417_11350 biopolymer transporter ExbB (Pseudomonas simiae WCS417)
MQRLFLSLLICLGFTLPATAHAWWQDDWHYRKQISVDTTAQGAAINQALGRTALLVRLHT
GNFTFDGVKDDGADLRFVSADDKTVFNHQIESFDPLMGMALIWVDVPKVEGGQRQDLWMY
YGNQKAPATANGQLTFDPNYTALYHFDGANGTPARDTTAYANTALNATGVSIDGVIGRAL
QFNGQALMLPASPSLQHAAGGAFTFSAWLRLDQASGEQVVLARRDGPHSLLLGLNQGMPF
VDIDGQRAVSTQPLNPGQWQHLAFTAEGDKVSLYVNGRETATLAVALPAFNTPLAIGADL
PEAGNTRPPFAGAIDELRLSKVARPAALLLADASAQGAESKLVAYGVDEEQSGFGFGSLG
FLLNAVPVDAWVIILVLVAMMFQSWVIMLRKNRQVSRVSSANEVFREHFAQIGTRLEMYA
DDAPLGERLAHSSLWRLYLVAVKEIRTRRAQGADTSSVSAATIEAIRCSMDGVRTRENQV
LSSKLSTLSNAIAGGPYIGLLGTVLGIMVVFLGTAMAGDVNINAIAPGMAAALLATAMGL
FVAIPALFGYNRLITRNKEVSADMRVFVDEFITRLAEMHGESQHSEAAHRRDHHAPVLA