Protein Info for GFF2221 in Xanthobacter sp. DMC5

Annotation: Biosynthetic peptidoglycan transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00912: Transgly" amino acids 40 to 194 (155 residues), 135 bits, see alignment E=1e-43

Best Hits

Swiss-Prot: 57% identical to MTGA_RHOPS: Biosynthetic peptidoglycan transglycosylase (mtgA) from Rhodopseudomonas palustris (strain BisB5)

KEGG orthology group: K03814, monofunctional biosynthetic peptidoglycan transglycosylase [EC: 2.4.1.-] (inferred from 82% identity to xau:Xaut_0206)

Predicted SEED Role

"Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.2.-

Use Curated BLAST to search for 2.4.1.- or 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF2221 Biosynthetic peptidoglycan transglycosylase (Xanthobacter sp. DMC5)
MIRLVLRVVLILAAIPLVLSVLYNVINPVSTLMIGRWITGERVERIWTPIEKMSPALVRT
VIASEDASFCHNIGIDIAELRQAIEKADDLEDTRGASTIPMQIAKNLFLWPGRDYIRKAI
EMPLAIWLDLVVSKRRLIEIYLNIAEWGPNGEFGVEAGARRAFGIPAAQVDARQAALLAV
MLPNPHRRDAGNPTAGVQRLAARLQARVPKEGPELVACLGPLR